Last updated: May 2026
Summary: Sermorelin is a synthetic truncated analog of growth hormone-releasing hormone (GHRH 1-29). PeptideDropship supplies research-grade Sermorelin to verified B2B partners under strict research-use-only labeling. 99%+ purity verified by HPLC and mass spectrometry, third-party COAs per batch, no MOQ, US 24-hour fulfillment. For research use only — not for human consumption.
Technical specifications
| Parameter | Value |
|---|---|
| Peptide name | Sermorelin (GHRH 1-29) |
| Type | Truncated synthetic analog of growth hormone-releasing hormone |
| Sequence (1-letter) | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
| Molecular formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
| Molecular weight | 3357.93 g/mol |
| CAS number | 86168-78-7 |
| Form | Lyophilized white powder |
| Standard pack sizes | 2 mg, 5 mg vials |
| Storage | −20°C lyophilized; 2–8°C after reconstitution |
Manufacturing and quality control
Sermorelin is produced via solid-phase peptide synthesis (SPPS). Every production batch is independently verified by a third-party analytical laboratory before release.
- Mass spectrometry — confirms molecular weight matches the 29-amino-acid target
- Reverse-phase HPLC — quantifies purity to the 99%+ partner-grade standard
- Counterion content — documented salt form
- Water content — Karl Fischer titration
- Endotoxin — LAL test available on request
The full Certificate of Analysis ships with every order, documenting batch number, manufacture date, lab partner, and acceptance criteria.
Wholesale availability
- No minimum order quantity
- Tiered pricing — per-unit cost decreases at higher monthly volume
- 24-hour fulfillment from US-based warehouse
- API integration available
- Real-time stock visibility in the partner portal
White-label and private-label options
- Generic — PeptideDropship branding
- White-label — your label, packaging, inserts; supplier invisible to end customer
- Private-label — custom pack sizes or custom formulation, higher minimums
See the white-label vs. private-label guide for a side-by-side comparison.
Packaging, shipping, and storage
Sermorelin ships as lyophilized powder in sealed amber vials with tamper-evident closure. Each shipment includes the batch-specific COA. Standard packaging includes shock-protection inserts for vial protection during transit. Cold-chain shipping is available; the lyophilized form is stable at room temperature for short-duration shipping.
Compliance and labeling
Sermorelin is supplied to verified B2B partners exclusively for research use under strict research-use-only labeling. Resellers and end users are responsible for the labeling, FDA disclaimer, and compliance with state, local, and international regulations governing research-peptide distribution. Sermorelin is also a regulated compound in certain therapeutic contexts; resellers offering it in any context other than strict research-use-only must independently verify the applicable regulatory pathway.
FAQ
How does Sermorelin compare to CJC-1295?
Both are synthetic analogs of GHRH (1-29). Sermorelin is the unmodified 29-amino-acid sequence. CJC-1295 is a modified version of the same parent sequence; CJC-1295 “with DAC” adds a maleimidopropionyl-lysine modification that significantly extends serum half-life. The three (Sermorelin, CJC-1295 with DAC, CJC-1295 without DAC) are chemically distinct compounds with different molecular weights, different stability profiles, and different research applications.
What pack sizes are available?
Standard pack sizes are 2 mg and 5 mg lyophilized vials. Custom pack sizes are available through private-label fulfillment.
What’s the standard purity?
99%+ purity verified by HPLC and confirmed by mass spectrometry on every batch. The COA documents the full analytical methodology.
How is Sermorelin stored?
Lyophilized at −20°C for long-term stability. After reconstitution, store at 2–8°C and use within the documented stability window for the relevant research application.
Are sample COAs available?
Yes. Verified partners can request representative COAs from recent batches before placing an order.
Get started
Apply for verified partner access — verification takes 1–3 business days. See the peptide dropshipping guide for the business model and the CJC-1295 page for the closely related GHRH analog.
These statements have not been evaluated by the FDA. Not intended to diagnose, treat, cure, or prevent any condition. For research purposes only — not for human consumption. PeptideDropship sells research-grade peptides exclusively to verified B2B partners under research-use-only labeling.